OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Gimap1 (NM_175860) Mouse Recombinant Protein

Be the first to review this product
SKU
TP521664
Purified recombinant protein of Mouse GTPase, IMAP family member 1 (Gimap1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Gimap1 or NM_175860"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR221664 protein sequence
Red=Cloning site Green=Tags(s)

MGGRKMARDEEDAYGSEDSRAPQMPQLRLILVGRTGTGKSATGNSILGQKCFLSRLGAVPVTRSCTLASR
MWAGWQVEVVDTPDIFSSEIPRTDPGCVETARCFVLSAPGPHALLLVTQLGRFTMQDSQALAAVKRLFGK
QVMARTVVVFTRQEDLAGDSLQDYVHCTDNRALRDLVAECGGRVCALNNRATGSEREAQAEQLLGMVACL
VREHGGAHYSNEVYELVQDTRCADPQDQVAKVAEIVAERMQRRTRLLAGLWGWRKFYWKGWRRGFSVFLG
VAILIYLLFYRKGFGDQNNR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_787056
Locus ID 16205
UniProt ID Q3TFI6
Cytogenetics 6 B2.3
RefSeq Size 1499
RefSeq ORF 900
Synonyms 38kD; i; IA; IAP38; Ima; imap; Imap38
Summary This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. Sequence analysis identified two alternatively spliced variants that encode the same protein. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products