Snx21 (NM_133924) Mouse Recombinant Protein

CAT#: TP521413

Purified recombinant protein of Mouse sorting nexin family member 21 (Snx21), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR221413 representing NM_133924
  Red=Cloning site Green=Tags(s)
  
  MASRLLHRLRHALASDGPGEAAAGPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDPDDEDEDDEA
  GLDSPPSGDGASGEDAERSPPPDGQRSSQLLARQLQDFWKKSRNTLVPQRLLFEVTSANVVKDPPSKYVL
  YTLAVMGPGPPDRQPAQISRRYSDFERLHRNLQRQFRGPMSAISFPRKRLRRNFTAETIARRSRAFEQFL
  GHLQAVPELRQAPDLQDFFVLPELRRAQSLTCTGLYREALALWANAWQLQTQLGTPSGPDRPLLTLAGLA
  VCHQELEDPGEARACSEKALQLLGDKRPHPFLAPFLEAHVRLSWRLGLDKRQSEAQLQALQEAGLTSTPP
  PSLKELLIKEVLD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 40.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598685
• Locus ID: 101113
• UniProt ID: Q3UR97
• Cytogenetics: 2 H3
• Refseq Size: 1520
• Refseq ORF: 1089
• Synonyms: 5730407K14Rik; AI481716
• Summary: Binds to membranes enriched in phosphatidylinositol 3-phosphate (PtdIns(P3)) and phosphatidylinositol 4,5-bisphosphate (PubMed:25882846). May be involved in several stages of intracellular trafficking.[UniProtKB/Swiss-Prot Function]