OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Chordc1 (NM_025844) Mouse Recombinant Protein

Be the first to review this product
SKU
TP520787
Purified recombinant protein of Mouse cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1 (Chordc1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Chordc1 or NM_025844"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR220787 representing NM_025844
Red=Cloning site Green=Tags(s)

MALLCYNRGCGQRFDPEANSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPP
EPVKPEVKTTEKKELSELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGSE
EDKKEEDSDEIKIGTSCKNGGCSKTYQGLQSLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEG
CTRGKHVWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSQVEANSTLLNVHIVFEGEKEFHQNV
KLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASLELPTTKKQEKQKDIAD

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_080120
Locus ID 66917
UniProt ID Q9D1P4
Cytogenetics 9 A2
RefSeq Size 2205
RefSeq ORF 993
Synonyms 1110001O09Rik; AA409036; Chp-1; morgana
Summary Regulates centrosome duplication, probably by inhibiting the kinase activity of ROCK2. Proposed to act as co-chaperone for HSP90. May play a role in the regulation of NOD1 via a HSP90 chaperone complex. In vitro, has intrinsic chaperone activity. This function may be achieved by inhibiting association of ROCK2 with NPM1. Involved in stress response. Prevents tumorigenesis (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products