OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Amn (NM_033603) Mouse Recombinant Protein

Be the first to review this product
SKU
TP520642
Purified recombinant protein of Mouse amnionless (Amn), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Amn or NM_033603"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR220642 representing NM_033603
Red=Cloning site Green=Tags(s)

MGALGRVLLWLQLCAMTRAAYKLWVPNTSFDTASNWNQNRTPCAGDAVQFPADKMVSVLVRDSHAISDML
LPLDGELVLASGAALSAAGGDSDPACNPGAPLLFRNPDRFSWLDPHLWSSGTQAPGLFSVDAERVPCSYD
DVLFPRDGSFRVALGPGPNPVHVRSVSAVGQTFSRDEDLTAFLASREGRLRFHGSGALRVGSQACTDASG
CVCGNAEMLPWICASLLQPLGGRCPQAACQDPLLPQGQCCDLCGAIVSLTHDPTFDLERYRARLLDLFLK
QPQYQGLQVAVSKVLRDAHTEIQVVLVETEHATGAAGQLGHALLQDAVAQGSVLGIVSATLRQSGKPMTA
DSELNQSSSGAGLAGGVAALVLLALLGTVLLLLHRSGRLRWRRHEDAEPVSAGLPLGFRNPIFDAIVFKQ
QPSVELPDSAQKVDILDIDTKFGCFVNPLFAGEAEAEA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 49.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_291081
Locus ID 93835
UniProt ID Q99JB7
Cytogenetics 12 60.94 cM
RefSeq Size 1685
RefSeq ORF 1374
Summary This gene encodes a type I transmembrane protein. The encoded protein is an essential component of the cubulin receptor complex which is thought to play a role in coordinating growth and patterning of the embryo. This protein is thought to modulate a bone morphogenetic protein (BMP) signaling pathway. A homoygous mutation in the mouse gene results in the lack of an amnion in embryos. Mutations in the human gene are associated with Megaloblastic Anemia-1. provided by RefSeq, Sep 2015
Protein Categories Cardiovascular diseases, Intracellular Proteins, Membrane Proteins, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products