OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Klk11 (NM_019974) Mouse Recombinant Protein

Be the first to review this product
SKU
TP520496
Purified recombinant protein of Mouse kallikrein related-peptidase 11 (Klk11), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Klk11 or NM_019974"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR220496 representing NM_019974
Red=Cloning site Green=Tags(s)

MILRLIALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKPHYVIL
LGEHNLEKTDGCEQRRMATESFPHPDFNNSLPNKDHRNDIMLVKMSSPVFFTRAVQPLTLSPHCVAAGTS
CLISGWGTTSSPQLRLPHSLRCANVSIIEHKECEKAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNG
SLQGIISWGQDPCAVTRKPGVYTKVCKYFNWIHEVMRNN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064358
Locus ID 56538
UniProt ID Q9QYN3
Cytogenetics 7 B3
RefSeq Size 1285
RefSeq ORF 747
Synonyms 2310015I08Rik; hi; Pr; Prss20; T; TLSP
Summary This gene encodes a member of the kallikrein subfamily of serine proteases that are involved in diverse physiological functions such as skin desquamation, tooth enamel formation, seminal liquefaction, synaptic neural plasticity and brain function. The encoded preproprotein undergoes proteolytic cleavage of the activation peptide to generate the functional enzyme. This gene is located in a cluster of several related kallikrein genes on chromosome 7. provided by RefSeq, May 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products