Ccdc114 (NM_001033243) Mouse Recombinant Protein

CAT#: TP520438

Reviews ()
Write a review

Purified recombinant protein of Mouse coiled-coil domain containing 114 (Ccdc114), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



USD 988.00

6 Weeks*

Size
    • 20 ug

Product images

Frequently bought together (1)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "Ccdc114"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR220438 representing NM_001033243
Red=Cloning site Green=Tags(s)

MMELERRAYSKEVHQRLRKQVEEIRQLEMLRAKLQTQINVAQSQVKRLGDKKHLAEMECLLKSRAQVQVE
IEALQEQNRALDKQIQDWETHVLTQSKEASAPDLIMYQKMKIQRRIRILEDQLDRVTCHFDIHLVRNAAL
REELELLRIERGRYLNMDRKLKKEIHLLREMVGALSTSSTSAYTAREEAKTKMGMLQERAEKELAQSDTE
AQILLRQISHLEQLHRFLKLKNDERQPDPRVVQKAEQRDWEVSEGLRKTSQEKLVLRYEDTLGKLAQLTG
ESDPDLLVEKYLELEERNFAEFNFINEQNSEIHHLQEEIKEMQEALVSEHASQDKQRMQQEQQCKMLQQD
VDKMCSESEQLEGRFQVLRGQLEKIKTDIQVLFDKAKCDSSVIKDLLGVKTYMRDRDIGLFLSTIERRLV
QLLTVQAFLQVQNLAPLADAALLALGQSLQEPSKKTTPLKPPDTMEDSSGAVIKEDYPMSKEELLSQVMK
SLQLQDEEESAKKLDSSPSLTLSSPQISLVTVPKHSKKTSVVPESILSHKTNRGRGTGSVSHVTFGDSAS
AAGPVAMASASASGAPVSSRSSQGGRGGFKPTSSSSYLGSTGYLETSRGRESTAGGVHSQSMGSELSRGL
SSSSGHASSPAPPSRPSSSTSKDSRGYN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 74.1 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 211535
UniProt ID Q3UX62
Cytogenetics 7 B3
Refseq Size 2453
Refseq ORF 1974
Summary Probable component of the outer dynein arm complex required along the entire axoneme for tethering of outer dynein arms.[UniProtKB/Swiss-Prot Function]

Documents

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.