Cotl1 (NM_028071) Mouse Recombinant Protein

CAT#: TP519968

Purified recombinant protein of Mouse coactosin-like 1 (Dictyostelium) (Cotl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR219968 representing NM_028071
  Red=Cloning site Green=Tags(s)
  
  MATKIDKEACRAAYNLVRDDGSAVIWVTFRYDGATIVPGDQGADYQHFIQQCTDDVRLFAFVRFTTGDAM
  SKRSKFALITWIGEDVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIRSELKKAGGANYDAQ
  SE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 16.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_082347
• Locus ID: 72042
• UniProt ID: Q9CQI6, Q544F6
• Cytogenetics: 8 E1
• Refseq Size: 1642
• Refseq ORF: 426
• Synonyms: 1810074P22Rik; 2010004C08Rik; Clp
• Summary: Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization. Acts as a chaperone for ALOX5 (5LO), influencing both its stability and activity in leukotrienes synthesis (By similarity).[UniProtKB/Swiss-Prot Function]