Cacng5 (NM_080644) Mouse Recombinant Protein

CAT#: TP519914

Purified recombinant protein of Mouse calcium channel, voltage-dependent, gamma subunit 5 (Cacng5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR219914 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWRVCFLAGEERG
  RCFTIEYVMPMNSQMTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNIGHIRPHRTILAFVSGIFFIL
  SGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMY
  RPHPGFYRPRLSNCSDYSGQFLHPDAWIRGRSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 30.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_542375
• Locus ID: 140723
• UniProt ID: Q8VHW4, Q544Q4
• Cytogenetics: 11 E1
• Refseq Size: 3678
• Refseq ORF: 828
• Summary: Regulates the gating properties of AMPA-selective glutamate receptors (AMPARs). Modulates their gating properties by accelerating their rates of activation, deactivation and desensitization. Displays subunit-specific AMPA receptor regulation. Shows specificity for GRIA1, GRIA4 and the long isoform of GRIA2. Thought to stabilize the calcium channel in an inactivated (closed) state (By similarity).[UniProtKB/Swiss-Prot Function]