OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tgm4 (NM_177911) Mouse Recombinant Protein

Be the first to review this product
SKU
TP519427
Purified recombinant protein of Mouse transglutaminase 4 (prostate) (Tgm4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Tgm4 or NM_177911"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR219427 representing NM_177911
Red=Cloning site Green=Tags(s)

MDSRNVLIIYAVNVERKLNAAAHHTSEYQTKKLVLRRGQIFTLKVILNRPLQPQDELKVTFTSGQRDPPY
MVELDPVTSYRSKGWQVKIAKQSGVEVILNVISAADAVVGRYKMRVNEYKAGVFYLLFNPWCSDDSVFMA
SEEERAEYILNDTGYMYMGFAKQIKEKPWTFGQFEKHILSCCFNLLFQLENNEMQNPVLVSRAICTMMCA
ANGGVLMGNWTGDYADGTAPYVWTSSVPILQQHYVTRMPVRYGQCWVFSGILTTALRAVGIPARSVTNFE
SAHDTEKNLTVDIYLDESGKTIPHLTKDSVWNFHVWTDAWMKRQDLPHGYDGWQVLDSTPQEISDGGFRT
GPSPLTAIRQGLIQMKYDTTFVFTEVNGDKFIWLVKQNQEREKNILIAVETASIGKKISTKMVGENRRED
ITLQYKFPEGSPEERKVMAKASGKPSDDKLNSRTLNNSLQISVLQNSLELGAPIYLTITLKRKTATPQNV
NISCSLNLQTYTGNKKTNLGVIQKTVQIHGQESRVFLTMDASYYIYKLGMVDDEMVIGGFIIAEIVDSGE
RVATDTTLCFLYSAFSVEMPSTGKVKQPLVITSKFTNTLPIPLTNIKFSVESLGLANMKSWEQETVPPGK
TITFQMECTPVKAGPQKFIVKFISRQVKEVHAEKVVLISK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 75.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_808579
Locus ID 331046
UniProt ID Q8BZH1
Cytogenetics 9 F4
RefSeq Size 2767
RefSeq ORF 2010
Synonyms 9530008N10Rik; Eapa1; TGP
Summary Associated with the mammalian reproductive process. Plays an important role in the formation of the seminal coagulum through the cross-linking of specific proteins present in the seminal plasma. Transglutaminase is also required to stabilize the copulatory plug.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Transglutaminase 4 as a prostate autoantigen in male subfertility
Landegren, Sharon, Shum et al
Sci Transl Med (2015) 7 (292), 292ra101 DOI: 10.1126/scitranslmed.aaa9186
Cited by 67
AI Summary: OriGene’s human TGM4 cDNA (SC303287) was used to produce radiolabeled TGM4 protein for immunoprecipitation assays, enabling the detection of TGM4 autoantibodies in patient sera in this study.
Snippet: TGM4 autoantibodies were measured in serum by immunoprecipitation with radiolabeled TGM4 protein. Human TGM4 complimentary DNA (cDNA) (SC303287, OriGene) was cloned into pTNT vector (L5610, Promega) and was used for in vitro transcription and translation in the presence of [35S]methionine (Promega TNT Systems)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products