Epgn (NM_053087) Mouse Recombinant Protein

CAT#: TP519218

Purified recombinant protein of Mouse epithelial mitogen (Epgn), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR219218 representing NM_053087
  Red=Cloning site Green=Tags(s)
  
  MALGVLIAVCLLFKAMKAALSEEAEVIPPSTAQQSNWTFNNTEADYIEEPVALKFSHPCLEDHNSYCING
  ACAFHHELKQAICRCFTGYTGQRCEHLTLTSYAVDSYEKYIAIGIGVGLLISAFLAVFYCYIRKRCINLK
  SPYIICSGGSPL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 17.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444317
• Locus ID: 71920
• UniProt ID: Q924X1, Q0VEB7
• Cytogenetics: 5 E1
• Refseq Size: 1704
• Refseq ORF: 456
• Synonyms: 2310069M11Rik; epigen
• Summary: Promotes the growth of epithelial cells. May stimulate the phosphorylation of EGFR and mitogen-activated protein kinases.[UniProtKB/Swiss-Prot Function]