OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ulk3 (NM_027895) Mouse Recombinant Protein

Be the first to review this product
SKU
TP519200
Purified recombinant protein of Mouse unc-51-like kinase 3 (Ulk3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ulk3 or NM_027895"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR219200 protein sequence
Red=Cloning site Green=Tags(s)

MAGPSWGLPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLLTEIEILKGIR
HPHIVQLKDFQWDNDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKP
QNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCRRQYDARVDLWSVGVILYEALFGQ
PPFASRSFSELEEKIRSNRVIELPLRPQLSLDCRDLLQRLLERDPARRISFKDFFAHPWVDLEHMPSGES
LAQARALVVEAVKKDQEGDAAAALSLYCKALDFFVPALHYEVDAQRKEAIKAKVGQYVSRAEELKAIVSS
SNQALLRQGTTVQELLREMARDKPRLLAALEVASAALAKEEEAGKEQDALDLYQHSLGELLVLLAAEAPG
RRRELLHTEVQNLMARAEYLKEQIKIRESHWEAESLDKEGLSESVRSSCTLQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_082171
Locus ID 71742
UniProt ID Q3U3Q1
Cytogenetics 9 B
RefSeq Size 2826
RefSeq ORF 1416
Synonyms 1200015E14Rik
Summary Serine/threonine protein kinase that acts as a regulator of Sonic hedgehog (SHH) signaling and autophagy. Acts as a negative regulator of SHH signaling in the absence of SHH ligand: interacts with SUFU, thereby inactivating the protein kinase activity and preventing phosphorylation of GLI proteins (GLI1, GLI2 and/or GLI3). Positively regulates SHH signaling in the presence of SHH: dissociates from SUFU, autophosphorylates and mediates phosphorylation of GLI2, activating it and promoting its nuclear translocation. Phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently. Also acts as a regulator of autophagy: following cellular senescence, able to induce autophagy (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Enzyme: Kinases, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products