Abhd17b (NM_146096) Mouse Recombinant Protein

CAT#: TP519043

Purified recombinant protein of Mouse abhydrolase domain containing 17B (Abhd17b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR219043 representing NM_146096
  Red=Cloning site Green=Tags(s)
  
  MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFM
  TRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEK
  NLYADVEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYC
  FDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQF
  VSQELVNL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 32.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666208
• Locus ID: 226016
• UniProt ID: Q7M759
• Cytogenetics: 19 B
• Refseq Size: 2475
• Refseq ORF: 864
• Synonyms: 5730446C15Rik; Cgi67; Fam108b; Fam108b1
• Summary: Hydrolyzes fatty acids from S-acylated cysteine residues in proteins (PubMed:27307232). Has depalmitoylating activity towards DLG4/PSD95 (PubMed:27307232). Has depalmitoylating activity towards GAP43 (PubMed:27307232). Has depalmitoylating activity towards MAP6 (PubMed:28521134). Has depalmitoylating activity towards NRAS (By similarity).[UniProtKB/Swiss-Prot Function]