Slc16a13 (NM_172371) Mouse Recombinant Protein

CAT#: TP517853

Purified recombinant protein of Mouse solute carrier family 16 (monocarboxylic acid transporters), member 13 (Slc16a13), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR217853 representing NM_172371
  Red=Cloning site Green=Tags(s)
  
  MVRRAEPPDGGWGWMVVLSAFFQSALVFGVLRSFGVFFVEFVAAFEEQAARVSWIASIGIAVQQFGSPIG
  SALSTKLGPRPVVMTGGILAALGMLLASFATSLTHLYLSIGLLSGSGWALTFTPTMACLSRYFSQRRSLA
  MGLALTGVGISSFAFAPLFQWLINNYAWRGALLLVSALSLHLMACGALLRPLSLTEDAAVGGPGAQITSL
  LRHGPFLRYTAALTLINTGFFIPYVHLVAHLQDLGWDPLPAAFLLSVAAVSDLVGRVASGWLGDAVPGPV
  ARLLMLWTTLTGVSLALFPVAQASSTLVVLAVAYGFTSGALTPVAFSVLPELVGTGRIYCGMGLVQMIES
  IGGLLGAPLSGYLRDVTGNYTASFVVAGAFLLAGSGVLLTLPHFFSCISVSTSRPQDLVIEASDTKIPLP
  KEEGLGEN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 45.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_758959
• Locus ID: 69309
• UniProt ID: Q8CE94
• Cytogenetics: 11 B3
• Refseq Size: 2528
• Refseq ORF: 1284
• Synonyms: 1700007D07Rik
• Summary: Proton-linked monocarboxylate transporter. May catalyze the transport of monocarboxylates across the plasma membrane.[UniProtKB/Swiss-Prot Function]