Kars (NM_053092) Mouse Recombinant Protein

CAT#: TP517682

Purified recombinant protein of Mouse lysyl-tRNA synthetase (Kars), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR217682 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATLQESEVKVDGEQKLSKNELKRRLKAEKKLAEKEAKQKELSEKQLNQTASAPNHTADNGVGAEEETLD
  PNQYYKIRSQAVQQLKVTGEDPYPHKFHVDISLTQFIQEYSHLQPGDHLTDVTLKVAGRIHAKRASGGKL
  IFYDLRGEGVKLQVMANSRNYKSEEEFVHINNKLRRGDIIGVEGNPGKTKKGELSIIPQEITLLSPCLHM
  LPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIVRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKP
  FITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLME
  ITEKMLSGMVKSITGSYKITYHPDGPEGQAYEVDFTPPFRRISMVEELEKALGVKLPETSLFETEETRKI
  LDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCISPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMK
  KEICNAYTELNDPVRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRLTMFLTDSN
  NIKEVLLFPAMKPEDKKETAATTETPESTEASPSV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 67.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444322
• Locus ID: 85305
• UniProt ID: Q99MN1, Q3TIV6
• Cytogenetics: 8 58.27 cM
• Refseq Size: 2045
• Refseq ORF: 1788
• Synonyms: AA589550; AL024334; AL033315; AL033367; D8Ertd698e; D8Wsu108e; LysRS; mKIAA0070
• Summary: Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA. When secreted, acts as a signaling molecule that induces immune response through the activation of monocyte/macrophages. Catalyzes the synthesis of the signaling molecule diadenosine tetraphosphate (Ap4A), and thereby mediates disruption of the complex between HINT1 and MITF and the concomitant activation of MITF transcriptional activity.[UniProtKB/Swiss-Prot Function]