Dars (NM_145507) Mouse Recombinant Protein

CAT#: TP517423

Purified recombinant protein of Mouse aspartyl-tRNA synthetase (Dars), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR217423 representing NM_145507
  Red=Cloning site Green=Tags(s)
  
  MPSTNASRKGQEKPREIVDAAEDYAKERYGISSMIQSQEKPDRVLVRVKDLTVQKADDVVWVRARVHTSR
  AKDWEPTDRLFFLFFNY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 10.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_663482
• Locus ID: 226414
• UniProt ID: Q8BJY7
• Cytogenetics: 1 E3
• Refseq Size: 702
• Refseq ORF: 261
• Synonyms: 5730439G15Rik
• Summary: Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.[UniProtKB/Swiss-Prot Function]