OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Hus1 (NM_008316) Mouse Recombinant Protein

Be the first to review this product
SKU
TP517345
Purified recombinant protein of Mouse HUS1 checkpoint clamp component (Hus1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Hus1 or NM_008316"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR217345 representing NM_008316
Red=Cloning site Green=Tags(s)

MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQENFFSEFQME
GVSEENNEIYLELTSENLSRALKTAQNSRALKIKLTNKHFPCLTVSVELQVSSSSSSRIVVHDIPIKVLP
RRLWKDLQEPSIPDCDVSICLPALKMMKSVVEKMRNISNQLVIEANLKGELNLKIETELVCVTTHFKDLE
NPLLPSDSVSQNRHPEDMAKVHIDIKKLLQFLAGQQVTPTKAVCNIVNNRTVHFDLLLEDVSLQYFIPAL
S

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_032342
Locus ID 15574
UniProt ID Q8BQY8
Cytogenetics 11 5.74 cM
RefSeq Size 4581
RefSeq ORF 843
Summary This gene encodes a component of a cell cycle checkpoint complex that causes cell cycle arrest in response to bulky DNA lesions and DNA replication blockage. Together with the proteins Rad9 and Rad1, the encoded protein forms a heterotrimeric complex known as the 9-1-1 complex. Mice lacking the encoded protein develop spontaneous chromosomal abnormalities resulting in embryonic lethality. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Jan 2015
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products