OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tmx2 (NM_025868) Mouse Recombinant Protein

Be the first to review this product
SKU
TP516986
Purified recombinant protein of Mouse thioredoxin-related transmembrane protein 2 (Tmx2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Tmx2 or NM_025868"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR216986 representing NM_025868
Red=Cloning site Green=Tags(s)

MAVLAPLIALVYSVPRLSRWLARPYCLLSALLSIAFLLVRKLPPICNGLPTQREDGNPCDFDWREVEILM
FLSAIVMMKNRRSITVEQHVGNIFMFSKVANAILFFRLDIRMGLLYLTLCIVFLMTCKPPLYMGPEYIKY
FNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCSGLNFGKVDVGRYTDVSTRYKVST
SPLTRQLPTLILFQGGKEVIRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKHSKGGDMSEEKPVD
PAPTTVPDGENKKDK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_080144
Locus ID 66958
UniProt ID Q9D710
Cytogenetics 2 D
RefSeq Size 2287
RefSeq ORF 885
Synonyms 2310042M24Rik; AA589631; Txndc14
Summary Endoplasmic reticulum and mitochondria-associated protein that probably functions as a regulator of cellular redox state and thereby regulates protein post-translational modification, protein folding and mitochondrial activity. Indirectly regulates neuronal proliferation, migration, and organization in the developing brain.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products