OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Polh (NM_030715) Mouse Recombinant Protein

Be the first to review this product
SKU
TP516957
Purified recombinant protein of Mouse polymerase (DNA directed), eta (RAD 30 related) (Polh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Polh or NM_030715"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR216957 representing NM_030715
Red=Cloning site Green=Tags(s)

MAPGQNRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRNMWADDAKK
LCPDLLLAQVRESRGKANLTKYREASVEVMEIMSYFAVIERASIDEAYIDLTSAVQERLQKLQGQPISAD
LLPSTYIEGLPRGPTVEETVQKEAIRKQGLLQWLDSLQSDDPTSPDLRLTVGAMIVEEMRAAIESKTGFQ
CSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEVLGIEYMGDLTQF
TESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLALELEER
LTKDRNDNDRVATQLVVSIRFQGDRRLSSLRRCCALPRYDAHKMSQDAFAAIRNCNTSGIQTEWSPPLTM
LFLCATKFSAAAPPACTDITAFLSSDSSCQPKVPIASSETRTQGSGPAVPTSKEAATSLASFFQKAAKKQ
RMKETSFVPLNTATEKLSSKPSLVFQSSQTTGSQSFFKQKSLLLQHTQLSNSAAPDPPQASPAAQPSCLP
AECVDSGPDDGAVKPVSSKAVSTEMNVAGDSPNVLDSPAYNSQEVTQRATEDQVLCEKCDSLVPVWDMPE
HTDYHFALELQKSFLQPCTSKPQAIPAVSPQGKRNPKSPSASSSKRLRPHGMQTLESFFKPLTH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 76.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_109640
Locus ID 80905
UniProt ID Q9JJN0
Cytogenetics 17 C
RefSeq Size 2580
RefSeq ORF 2082
Synonyms RAD30A; XPV
Summary DNA polymerase specifically involved in the DNA repair by translesion synthesis (TLS) (PubMed:10871396). Due to low processivity on both damaged and normal DNA, cooperates with the heterotetrameric (REV3L, REV7, POLD2 and POLD3) POLZ complex for complete bypass of DNA lesions. Inserts one or 2 nucleotide(s) opposite the lesion, the primer is further extended by the tetrameric POLZ complex. In the case of 1,2-intrastrand d(GpG)-cisplatin cross-link, inserts dCTP opposite the 3' guanine (By similarity). Particularly important for the repair of UV-induced pyrimidine dimers (PubMed:10871396). Although inserts the correct base, may cause base transitions and transversions depending upon the context. May play a role in hypermutation at immunoglobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have any lyase activity, preventing the release of the 5'-deoxyribose phosphate (5'-dRP) residue. This covalent trapping of the enzyme by the 5'-dRP residue inhibits its DNA synthetic activity during base excision repair, thereby avoiding high incidence of mutagenesis. Targets POLI to replication foci (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products