OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Slc39a7 (NM_001077709) Mouse Recombinant Protein

Be the first to review this product
SKU
TP516531
Purified recombinant protein of Mouse solute carrier family 39 (zinc transporter), member 7 (Slc39a7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Slc39a7 or NM_001077709"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR216531 representing NM_001077709
Red=Cloning site Green=Tags(s)

MTMGLRAPHWVAVGLLTWAALGLLVAGHEGHGDLHKDVEEDFHGHSHGHSHEDFHHGHSHGHSHEDFHHG
HGHTHESIWHGHAHSHDHGHSREELHHGHSHGHSHDSLHHGGHGHAHREHSHGTSREAGAPGIKHHLDTV
TLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGLLGDAFLHLIPHALEPHSHHAPE
QPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGHSHGHGDRHAHGDSHTHGDRHECSSKE
KPSTEEEKEVGGLRKRRGGNTGPRDGPVKPQSPEEEKAGSDLRVSGYLNLAADLAHNFTDGLAIGASFRG
GRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLVTAIGALAGTACALLTEGGAVDSDVAGG
AGPGWVLPFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVAMMVLIAHLE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 51.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001071177
Locus ID 14977
UniProt ID Q31125
Cytogenetics 17 17.98 cM
RefSeq Size 2113
RefSeq ORF 1428
Synonyms AA408174; AI117660; AL024048; H-2Ke4; H2-Ke4; Ke-4; Ke4; Ring5; Zip7
Summary Zinc transporter, that transports Zn(2+) from the endoplasmic reticulum/Golgi apparatus to the cytosol.UniProtKB/Swiss-Prot Function
Protein Categories Immune system diseases, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

The Zinc Transporter Zip7 Is Downregulated in Skeletal Muscle of Insulin-Resistant Cells and in Mice Fed a High-Fat Diet
Norouzi, Adulcikas, Henstridge et al
Cells (2019) 8 (7) DOI: 10.3390/cells8070663
AI Summary: OriGene’s pCMV-Zip7 plasmid (Clone ID MR216531) was used to overexpress the Zip7 protein in skeletal muscle cells, enabling the study of Zip7’s role in insulin signaling and glucose metabolism in the context of insulin resistance.
Snippet: 2.13. Zip7 Overexpression. To determine the role of Zip7 in modulating cellular pathways, a plasmid-based system was constructed that overexpressed the Zip7 protein (Origene, Rockville, MD, USA, Clone ID MR216531;plasmid cytomegalovirus, pCMV-Zip7) Cached
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products