Diras2 (NM_001024474) Mouse Recombinant Protein

CAT#: TP516101

Purified recombinant protein of Mouse DIRAS family, GTP-binding RAS-like 2 (Diras2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR216101 representing NM_001024474
  Red=Cloning site Green=Tags(s)
  
  MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPA
  MQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPNREVQSSEAEALA
  RTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVVM
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001019645
• Locus ID: 68203
• UniProt ID: Q5PR73, Q3UWU7
• Cytogenetics: 13 A5
• Refseq Size: 4348
• Refseq ORF: 597
• Synonyms: 2900052J15Rik; AI414999
• Summary: Displays low GTPase activity and exists predominantly in the GTP-bound form.[UniProtKB/Swiss-Prot Function]