B4galt2 (NM_017377) Mouse Recombinant Protein

CAT#: TP515821

Purified recombinant protein of Mouse UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (B4galt2), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified B4galt2 protein (Cat# TP515821). The protein was produced from HEK293T cells transfected with B4galt2 cDNA clone (Cat# MR215821) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR215821 representing NM_017377
  Red=Cloning site Green=Tags(s)
  
  MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSTRSPAHALYPAASSSTNCSRPNAT
  AASSGLPEVPSARPGPTAPVIPPCPDVPPGLVGRVVIEFTSPMPLERVQRENPGVLLGGRYSPPDCTPAQ
  TVAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGVYVINQHGEETFNRAKLLNVGFLEALKEDAAYDCFI
  FSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYASYFGGVSGLSKAQFLRINGFPNEYWGWGGEDD
  DIFNRISLTGMKISRPDVRIGRYRMIKHDRDKHNEPNPQRFNKIQNTKMSMKWDGIGSVRYRVLEVSRQP
  LFTNITVDIGQPMSWLTQG
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 42.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_059073
• Locus ID: 53418
• UniProt ID: Q9Z2Y2, B1ASJ2
• Cytogenetics: 4 D2.1
• Refseq Size: 2432
• Refseq ORF: 1107
• Synonyms: Ggtb2
• Summary: Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. Can produce lactose (By similarity).[UniProtKB/Swiss-Prot Function]