Cfap20 (NM_008187) Mouse Recombinant Protein

CAT#: TP514189

Purified recombinant protein of Mouse cilia and flagella associated protein 20 (Cfap20), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR214189 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLG
  IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLSDFT
  RRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032213
• Locus ID: 14894
• UniProt ID: Q8BTU1
• Cytogenetics: 8 C5
• Refseq Size: 1318
• Refseq ORF: 582
• Synonyms: 2600014O15Rik; AL024127; Gtl3; T10-2A2
• Summary: Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation (By similarity).[UniProtKB/Swiss-Prot Function]