OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Fbxo3 (NM_020593) Mouse Recombinant Protein

Be the first to review this product
SKU
TP513929
Purified recombinant protein of Mouse F-box protein 3 (Fbxo3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Fbxo3 or NM_020593"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR213929 representing NM_020593
Red=Cloning site Green=Tags(s)

MAAVEAETGLLTLESLPTDPLLLILSFVDYRDLINCCYVSRRLSQLSTHDPLWRRHCKKYWLISEEEKAG
KSQCWRSLFIETYSDVGRYIDHYAAIKKAWRDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPD
DYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAV
EAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVNNVVSGGFPIIRDQIFRYIHDPECVAT
TGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSRDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVG
EFPIISPGRIYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKVFNVAIPRFHMACPTFRVSIARLVS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_065618
Locus ID 57443
UniProt ID Q9DC63
Cytogenetics 2 E2
RefSeq Size 1404
RefSeq ORF 1245
Synonyms 1200002G09Rik; 1700026K02Rik; AI046358; Fba
Summary Substrate recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Mediates the ubiquitination of HIPK2 and probably that of EP300, leading to rapid degradation by the proteasome. In the presence of PML, HIPK2 ubiquitination still occurs, but degradation is prevented. PML, HIPK2 and FBXO3 may act synergically to activate p53/TP53-dependent transactivation (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products