Them4 (NM_029431) Mouse Recombinant Protein

CAT#: TP512675

Purified recombinant protein of Mouse thioesterase superfamily member 4 (Them4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR212675 representing NM_029431
  Red=Cloning site Green=Tags(s)
  
  MLRNCAMRLRTLGATPARRPGAARRLFSSEKVIRKDYALPNPSWTKDLRLLFDQFMKKCEDGSWKRMPSH
  RQNPTRAIQEFQTLFVDSKFKKEEQMSKAQQFTRSFEEGLGFEYAMFYNKVEKRTVSLFQGGLHLQGVPG
  FVHGGAIATIIDVTTGTCAISEGVAMTANLNITYKKPIPLLSVVVVNSQLQKIEGRKLFVSCTIQSIDEK
  TLYTEATALFIKLDPEKPLT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_083707
• Locus ID: 75778
• UniProt ID: Q3UUI3
• Cytogenetics: 3 F2.1
• Refseq Size: 1730
• Refseq ORF: 690
• Synonyms: 2700077M13Rik; 4921507I02Rik
• Summary: Has acyl-CoA thioesterase activity towards medium and long-chain (C14 to C18) fatty acyl-CoA substrates, and probably plays a role in mitochondrial fatty acid metabolism (By similarity). Plays a role in the apoptotic process, possibly via its regulation of AKT1 activity (PubMed:19421406).[UniProtKB/Swiss-Prot Function]