Nap1l4 (NM_008672) Mouse Recombinant Protein

CAT#: TP512438

Purified recombinant protein of Mouse nucleosome assembly protein 1-like 4 (Nap1l4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR212438 representing NM_008672
  Red=Cloning site Green=Tags(s)
  
  MAENSLSDGGPADSVEAAKNASNTEKLTDQVMQNPQVLAALQERLDNVSHTPSSYIETLPKAVKRRINAL
  KQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESAWHSENEEEDKLAGDMKNK
  VVIAEKEAATVEELNPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHF
  EPNDYFTNPVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTI
  TKQVPNESFFNFFSPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGE
  EGEEEELEGDEEGEDEDDADVNPKV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 42.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032698
• Locus ID: 17955
• UniProt ID: Q78ZA7, A2RSB1
• Cytogenetics: 7 88.24 cM
• Refseq Size: 2335
• Refseq ORF: 1125
• Synonyms: 2810410H14Rik; AI316776; D7Wsu30e; Nap2
• Summary: Acts as histone chaperone in nucleosome assembly (PubMed:28366643). In condensing spermatids, mediates the loading of the heterodimer composed of histones H2AFB1 and HIST1H2BA/TH2B onto the nucleosomes, thereby promoting the replacement of histones to protamine in male germ cells (PubMed:28366643).[UniProtKB/Swiss-Prot Function]