OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ddx1 (NM_134040) Mouse Recombinant Protein

Be the first to review this product
SKU
TP510392
Purified recombinant protein of Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 (Ddx1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ddx1 or NM_134040"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR210392 protein sequence
Red=Cloning site Green=Tags(s)

MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKD
QQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRGTRGLLKGKHYYEVSCH
DQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGK
DLGLAFEIPAHIKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDNYIVKSQHTGNAQVSQT
KFLPNAPKALIVEPSRELAEQTLNNVKQFKKYIDNPKLRELLIIGGVAARDQLSVLDNGVDIVVGTPGRL
DDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQITCDGKRLQVIVCSATLHSFDVKKLSE
KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDKLWERLGKNHIRTDDVHAKDNTRPGANSPEMWSEAIK
ILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFMQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLER
FKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHV
CSNRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGN
YKGHVDVLAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 82.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_598801
Locus ID 104721
UniProt ID Q91VR5
Cytogenetics 12 A1.1
RefSeq Size 2488
RefSeq ORF 2220
Synonyms AA409185; DBP-RB
Summary Acts as an ATP-dependent RNA helicase, able to unwind both RNA-RNA and RNA-DNA duplexes. Possesses 5' single-stranded RNA overhang nuclease activity. Possesses ATPase activity on various RNA, but not DNA polynucleotides. May play a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome. Together with RELA, acts as a coactivator to enhance NF-kappa-B-mediated transcriptional activation (By similarity). Acts as a positive transcriptional regulator of cyclin CCND2 expression (PubMed:19398953). Binds to the cyclin CCND2 promoter region (PubMed:19398953). Associates with chromatin at the NF-kappa-B promoter region via association with RELA. Binds to poly(A) RNA. May be involved in 3'-end cleavage and polyadenylation of pre-mRNAs. Component of the tRNA-splicing ligase complex required to facilitate the enzymatic turnover of catalytic subunit RTCB: together with archease (ZBTB8OS), acts by facilitating the guanylylation of RTCB, a key intermediate step in tRNA ligation (By similarity). Component of a multi-helicase-TICAM1 complex that acts as a cytoplasmic sensor of viral double-stranded RNA (dsRNA) and plays a role in the activation of a cascade of antiviral responses including the induction of proinflammatory cytokines via the adapter molecule TICAM1 (PubMed:21703541). Specifically binds (via helicase ATP-binding domain) on both short and long poly(I:C) dsRNA (PubMed:21703541).UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

A HIV-1 Tat mutant protein disrupts HIV-1 Rev function by targeting the DEAD-box RNA helicase DDX1
Lin, Sivakumaran, Jones et al
Retrovirology (2014) 11 (1), 121 DOI: 10.1186/PREACCEPT-7500780551442434
AI Summary: OriGene’s recombinant DDX1 and DDX3 proteins were used in this study to investigate and confirm the direct interaction between the HIV-1 Tat mutant Nullbasic and the cellular helicase DDX1, elucidating how Nullbasic disrupts HIV-1 Rev function.
Snippet: Recombinant proteins Recombinant DDX1 and DDX3 proteins were purchased from OriGene. The recombinant Nullbasic- FLAG-V5-6xHis was produced in E. coli strain BL21-AI (Invitrogen) transformed by pDEST42-Nullbasic-FLAG. A 200 ml culture was grown in Luria broth to log phase and induced with 0.2% arabinose and 1 mM IPTG
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products