Dpp3 (NM_133803) Mouse Recombinant Protein

CAT#: TP510374

Reviews ()
Write a review

Purified recombinant protein of Mouse dipeptidylpeptidase 3 (Dpp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



USD 988.00

6 Weeks*

Size
    • 20 ug

Product images

Frequently bought together (1)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "Dpp3"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR210374 protein sequence
Red=Cloning site Green=Tags(s)

MADTQYILPNDIGVSSLNCREAFRLLSPTERLYAHHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQ
DPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKDKLGRVILGSKAAQQRPEEV
RDLWQTCGDLMFSLEPRLRHLGLGKEGVTTYFSGDCTMEDAKLAQDFLDSQNLSAYNTRLFKVVDQEGKS
HYEVRLASVLNTDPALDSELTSKLKRYEFQGNHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQ
YVESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKAMSAKFERLVASA
EQLLKELPWPLAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYAAK
REKLTFLEEEDKDLYIRWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDKETVINPETGEQIQSWYR
SGETWDSKFSTIASSYEECRAESVGLYLCLNPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPE
AANWRQAHMQARFVILRVLLEAGEGLVTVTPTTGSDGRPDARVRLDRSKIRSVGRPALERFLRRLQVLKS
TGDVVAGRALYEGYAAVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSEVQLVEYEASAAGLIRSF
CERFPEDGPELEEVLIQLAAADARFWRNQAQEAPPGQA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 83 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598564
Locus ID 75221
UniProt ID Q99KK7, Q3UDF3
Cytogenetics 19 A
Refseq Size 2683
Refseq ORF 2217
Synonyms 4930533O14Rik; C86324; DPP III
Summary Cleaves and degrades bioactive peptides, including angiotensin, Leu-enkephalin and Met-enkephalin. Also cleaves Arg-Arg-beta-naphthylamide (in vitro).[UniProtKB/Swiss-Prot Function]

Documents

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.