Cdh8 (NM_001039154) Mouse Recombinant Protein

CAT#: TP510246

Reviews ()
Write a review

Purified recombinant protein of Mouse cadherin 8 (Cdh8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



USD 988.00

6 Weeks*

Size
    • 20 ug

Product images

Frequently bought together (1)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "Cdh8"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR210246 protein sequence
Red=Cloning site Green=Tags(s)

MPERLAETLMDLWTPLIILWITLPSCVYTAPMNQAHVLTTGSPLELSRQSEDMRILSRSKRGWVWNQMFV
LEEFSGPEPILVGRLHTDLDPGSKKIKYILSGDGAGTIFQINDITGDIHAIKRLDREEKAEYTLTAQAVD
FETNKPLEPPSEFIIKVQDINDNAPEFLNGPYHATVPEMSILGTSVTNVTATDADDPVYGNSAKLVYSIL
EGQPYFSIEPETAIIKTALPNMDREAKEEYLVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSL
YHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGVIRLRKPLDFETKKS
YTLKVEAANIHIDPRFSSRGPFKDTATVKIVVEDADEPPVFSSPTYLLEVHENAALNSVIGQVTARDPDI
TSSPIRFSIDRHTDLERQFNINADDGKITLATPLDRELSVWHNITIIATEIRNHSQISRVPVAIKVLDVN
DNAPEFASEYEAFLCENGKPGQVIQTVSAMDKDDPKNGHFFLYSLLPEMVNNPNFTIKKNEDNSLSILAK
HNGFNRQKQEVYLLPIVISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSMGALIAILAC
IILLLVIVVLFVTLRRHKNEPLIIKDDEDVRENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRWGL
PTQRWEERNAIQTGCV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 79.1 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001034243
Locus ID 12564
UniProt ID Q8C449
Cytogenetics 8 49.4 cM
Refseq Size 3822
Refseq ORF 2151
Synonyms AI851472; cad; cad8
Summary This gene encodes a member of the cadherin family of calcium-dependent glycoproteins that mediate cell adhesion and regulate many morphogenetic events during development. The encoded preproprotein is further processed to generate a mature protein. Mice lacking the encoded protein exhibit reduced behavioral responses to cold, but not thermal stimuli. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. Multiple distinct genes of the cadherin family, including this gene, are found on chromosome 8. [provided by RefSeq, Oct 2015]

Documents

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.