OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Bbs7 (NM_027810) Mouse Recombinant Protein

Be the first to review this product
SKU
TP510222
Purified recombinant protein of Mouse Bardet-Biedl syndrome 7 (human) (Bbs7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Bbs7 or NM_027810"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR210222 protein sequence
Red=Cloning site Green=Tags(s)

MDLTLSRADYLQVGVTSQKTMKLLPTSRQRATQKVVVGDQDGVVICFGVKKGEAVPVFKTLPGQKISRLE
LGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNY
YLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFG
TSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLR
FDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIE
HLQFKVLQERENYQQSSQSSQAKSTVPSFSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDV
DKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKP
LSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECATFYFQNTFLDTQLECVYRK
GEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALK
ELQVHEGNTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPMLLEIL
DSYDQNTLISFFDAA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 80.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_082086
Locus ID 71492
UniProt ID Q8K2G4
Cytogenetics 3 B
RefSeq Size 2598
RefSeq ORF 2145
Synonyms 8430406N16Rik
Summary The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. The BBSome complex, together with the LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation. Required for BBSome complex ciliary localization but not for the proper complex assembly (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products