OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Zp2 (NM_011775) Mouse Recombinant Protein

Be the first to review this product
SKU
TP510212
Purified recombinant protein of Mouse zona pellucida glycoprotein 2 (Zp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Zp2 or NM_011775"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR210212 representing NM_011775
Red=Cloning site Green=Tags(s)

MARWQRKASVSSPCGRSIYRFLSLLFTLVTSVNSVSLPQSENPAFPGTLICDKDEVRIEFSSRFDMEKWN
PSVVDTLGSEILNCTYALDLERFVLKFPYETCTIKVVGGYQVNIRVGDTTTDVRYKDDMYHFFCPAIQAE
THEISEIVVCRRDLISFSFPQLFSRLADENQNVSEMGWIVKIGNGTRAHILPLKDAIVQGFNLLIDSQKV
TLHVPANATGIVHYVQESSYLYTVQLELLFSTTGQKIVFSSHAICAPDLSVACNATHMTLTIPEFPGKLE
SVDFGQWSIPEDQWHANGIDKEATNGLRLNFRKSLLKTKPSEKCPFYQFYLSSLKLTFYFQGNMLSTVID
PECHCESPVSIDELCAQDGFMDFEVYSHQTKPALNLDTLLVGNSSCQPIFKVQSVGLARFHIPLNGCGTR
QKFEGDKVIYENEIHALWENPPSNIVFRNSEFRMTVRCYYIRDSMLLNAHVKGHPSPEAFVKPGPLVLVL
QTYPDQSYQRPYRKDEYPLVRYLRQPIYMEVKVLSRNDPNIKLVLDDCWATSSEDPASAPQWQIVMDGCE
YELDNYRTTFHPAGSSAAHSGHYQRFDVKTFAFVSEARGLSSLIYFHCSALICNQVSLDSPLCSVTCPAS
LRSKREANKEDTMTVSLPGPILLLSDVSSSKGVDPSSSEITKDIIAKDIASKTLGAVAALVGSAVILGFI
CYLYKKRTIRFNH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 80.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_035905
Locus ID 22787
UniProt ID P20239
Cytogenetics 7 64.38 cM
RefSeq Size 2200
RefSeq ORF 2139
Synonyms Zp-; Zp-2
Summary This gene encodes a member of the zona pellucida family of glycoproteins that play an important role in the survival of growing oocytes, successful fertilization and the passage of early embryos through the oviduct. The encoded preproprotein undergoes proteolytic processing to generate the mature polypeptide that is incorporated into the extracellular matrix surrounding mouse oocytes. Mice lacking the encoded protein develop defective zonae pellucidae that disrupt folliculogenesis, fertility and development. provided by RefSeq, Sep 2016
Protein Categories Membrane Proteins, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Human-specific features of the cerebellum and ZP2-regulated synapse development
Kim, Cherskov, Sindhwani et al
Cell (2026) 189 (6), 1802-1819.e28 DOI: 10.1016/j.cell.2026.02.014
Cited by 2
AI Summary: OriGene’s Human Recombinant ZP2 protein (Cat# TP319115) and Mouse Recombinant ZP2 protein (Cat# TP510212) were used in this study to investigate the role of ZP2 in human cerebellar synapse development and its evolutionary specialization.
Snippet: Human Recombinant ZP2 protein OriGene Cat# TP319115 Mouse Recombinant ZP2 protein OriGene Cat# TP510212
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products