Hps4 (NM_138646) Mouse Recombinant Protein

CAT#: TP509928

Purified recombinant protein of Mouse HPS4, biogenesis of lysosomal organelles complex 3 subunit 2 (Hps4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209928 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATTTPPETKSAAWWNYFFLYDGSKVKGEGDPTRAGICYFYPPQTLLDQQELLCGQLAGVVRCLWDLSGT
  PPMLIRMRNLKFAIRADGDYLWALGCGVEISDASCRQFLDQLIGFFHFYMGPVSLAYKSHPQEELSLQWD
  TSITQVLRSTSESHRIFNALWNLDRTKVEPLLLLKAALILQTCQRSPHVLAGCILYKGLIVNSQLLPSLT
  AKVLLHQTVPADQRLPGAGAAPQETGAALPPDVQITSVFLSEEEAASLHEFPVEHETRLQGSSVQYPPWD
  QSSPTQAEDAWASAAIPEPTPHDGACPSGSGADERLPRLEQECAGPTGLCTTACGQGSGLSSRLQKELCL
  SREELDSSEMHVSEAQEAFPPLPALGDLETLHSSHSAPTLPEDTAICSCLHPCPLERLPESGRLGQLADL
  PLTNGQTQVPGTDPLPSSMPVALPPQHPVGVEPSVEPYGNGAQESHSALPRSSRSPDSPGPSPSADRTGF
  KPSPSGRHAGLVPMNLYTHSVNGLVLSLLAEETLLSDTAAIEEVYHSSLASLNGLEVHLKETLPRDEASL
  TSSTYNFLHYDRIQSVLSANLPLVTAPQDRRFLQAVNLMHSDFALLPMLYEMTIRNASTAVYACSSPAQE
  TYFQQLAPTARSSGFPNPQDCAFSLAGKAKQKLLKHGVNLL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 72.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_619587
• Locus ID: 192232
• UniProt ID: Q99KG7, Q541V2
• Cytogenetics: 5 54.69 cM
• Refseq Size: 2852
• Refseq ORF: 2016
• Synonyms: 2010205O06Rik; AU040608; BLOC-3; C130020P05Rik; le; mKIAA1667
• Summary: Component of the BLOC-3 complex, a complex that acts as a guanine exchange factor (GEF) for RAB32 and RAB38, promotes the exchange of GDP to GTP, converting them from an inactive GDP-bound form into an active GTP-bound form. The BLOC-3 complex plays an important role in the control of melanin production and melanosome biogenesis and promotes the membrane localization of RAB32 and RAB38.[UniProtKB/Swiss-Prot Function]