Sema7a (NM_011352) Mouse Recombinant Protein

CAT#: TP509876

Purified recombinant protein of Mouse sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin) 7A (Sema7a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Sema7a"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209876 representing NM_011352
Red=Cloning site Green=Tags(s)

MTPPPPGRAAPSAPRARVLSLPARFGLPLRLRLLLVFWVAAASAQGHSRSGPRISAVWKGQDHVDFSQPE
PHTVLFHEPGSFSVWVGGRGKVYHFNFPEGKNASVRTVNIGSTKGSCQDKQDCGNYITLLERRGNGLLVC
GTNARKPSCWNLVNDSVVMSLGEMKGYAPFSPDENSLVLFEGDEVYSTIRKQEYNGKIPRFRRIRGESEL
YTSDTVMQNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWN
TFLKAMLVCSDAATNRNFNRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDRVFRTSSLK
GYHMGLPNPRPGMCLPKKQPIPTETFQVADSHPEVAQRVEPMGPLKTPLFHSKYHYQKVVVHRMQASNGE
TFHVLYLTTDRGTIHKVVESGDQDHSFVFNIMEIQPFHRAAAIQAISLDADRRKLYVTSQWEVSQVPLDM
CEVYSGGCHGCLMSRDPYCGWDQDRCVSIYSSQRSVLQSINPAEPHRECPNPKPDEAPLQKVSLARNSRY
YLTCPMESRHATYLWRHEENVEQSCEPGHQSPSCILFIENLTARQYGHYRCEAQEGSYLREAQHWELLPE
DRALAEQLMGHARALAASFWLGVLPTLILGLLVH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 75.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035482
Locus ID 20361
UniProt ID Q9QUR8
Cytogenetics 9 B
Refseq Size 3290
Refseq ORF 1992
Synonyms 2900057C09Rik; CDw108; H-Sema-L; M-Sema-L; Semal
Summary Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes.[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.