OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ly9 (NM_008534) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509585
Purified recombinant protein of Mouse lymphocyte antigen 9 (Ly9), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ly9 or NM_008534"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209585 representing NM_008534
Red=Cloning site Green=Tags(s)

MADLKRYWCDWALGPLSENPRMSQQQIFSPILWIPLLFLLMGLGASGKETPPTVISGMLGGSVTFSLNIS
KDAEIEHIIWNCPPKALALVFYKKDITILDKGYNGRLKVSEDGYSLYMSNLTKSDSGSYHAQINQKNVIL
TTNKEFTLHIYEKLQKPQIIVESVTPSDTDSCTFTLICTVKGTKDSVQYSWTREDTHLNTYDGSHTLRVS
QSVCDPDLPYTCKAWNPVSQNSSQPVRIWQFCTGASRRKTAAGKTVVGILGEPVTLPLEFRATRATKNVV
WVFNTSVISQERRGAATADSRRKPKGSEERRVRTSDQDQSLKISQLKMEDAGPYHAYVCSEASRDPSVRH
FTLLVYKRLEKPSVTKSPVHMMNGICEVVLTCSVDGGGNNVTYTWMPLQNKAVMSQGKSHLNVSWESGEH
LPNFTCTAHNPVSNSSSQFSSGTICSGPERNKRFWLLLLLVLLLLMLIGGYFILRKKKQCSSLATRYRQA
EVPAEIPETPTGHGQFSVLSQRYEKLDMSAKTTRHQPTPTSDTSSESSATTEEDDEKTRMHSTANSRNQV
YDLVTHQDIAHALAYEGQVEYEAITPYDKVDGSMDEEDMAYIQVSLNVQGETPLPQKKEDSNTIYCSVQK
PKKTAQTPQQDAESPETPTYENFT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 73.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_032560
Locus ID 17085
UniProt ID Q01965
Cytogenetics 1 79.54 cM
RefSeq Size 2449
RefSeq ORF 1962
Synonyms AI893573; CD229; Lgp100; Ly-9; SLAMF3; T100
Summary Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2 (PubMed:19648922). May participate in adhesion reactions between T lymphocytes and accessory cells by homophilic interaction. Promotes T-cell differentiation into a helper T-cell Th17 phenotype leading to increased IL-17 secretion; the costimulatory activity requires SH2D1A. Promotes recruitment of RORC to the IL-17 promoter (By similarity). May be involved in the maintenance of peripheral cell tolerance by serving as a negative regulator of the immune response. May disable autoantibody responses and inhibit IFN-gamma secretion by CD4(+) T-cells (PubMed:23914190). May negatively regulate the size of thymic innate CD8(+) T-cells and the development of invariant natural killer T (iNKT) cells (PubMed:23225888). Can promote natural killer (NK) cell activation (PubMed:19648922).UniProtKB/Swiss-Prot Function
Protein Categories CD Markers, Membrane Proteins, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products