Jph4 (NM_177049) Mouse Recombinant Protein

CAT#: TP509574

Purified recombinant protein of Mouse junctophilin 4 (Jph4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209574 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPGGKFDFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHSYQGHWQQGKR
  EGLGVERKSRWTYRGEWLGGLKGRSGVWESVSGLRYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKRHG
  YGVRQSVPYHQAALLRSPRRTSLDSGHSDPPTPPPPLPLPGDEGGSPASGSRGGFVLAGPGDADGASSRK
  RTPAAGGFFRRSLLLSGLRAGGRRSSLGSKRGSLRSEVSSEVGSTGPPGSEASGPPIPAPPALIEGSATE
  VYAGEWRADRRSGYGVSQRSNGLRYEGEWLGNRRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLA
  LRRGKVKEKVDRAVEGARRAVSAARQRQEIAAARAADALLKAVAASSVAEKAVEAARMAKLIAQDLQPML
  EAPGRRPRQDSGGSDTEPLDEDSPGVYENGLTPSEGSPELPSSPASSHQPWRAPACRSPLPPGGNWGPFS
  SPKAWPEEWGGPGEQAEELAGYEAEDEAGVQGPGPRDGSPLLGGCSDSSGSLREEEGEDEESLPQLRAPG
  GSESEPVTTPVLRGLSSRGPDAGCLTEEVEEPAPTERPAQPGAANPLVVGAVALLDLSLAFLFSQLLT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 66 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_796023
• Locus ID: 319984
• UniProt ID: Q80WT0
• Cytogenetics: 14 C3
• Refseq Size: 4489
• Refseq ORF: 1887
• Synonyms: 9330157P13Rik; JP-4; JPHL1
• Summary: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release channels. JPH4 is brain-specific and appears to have an active role in certain neurons involved in motor coordination and memory.[UniProtKB/Swiss-Prot Function]