OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Keap1 (NM_001110307) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509525
Purified recombinant protein of Mouse kelch-like ECH-associated protein 1 (Keap1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Keap1 or NM_001110307"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209525 protein sequence
Red=Cloning site Green=Tags(s)

MQPEPKLSGAPRSSQFLPLWSKCPEGAGDAVMYASTECKAEVTPSQDGNRTFSYTLEDHTKQAFGVMNEL
RLSQQLCDVTLQVKYEDIPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFA
YTASISVGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCTELHQRAREYIYMH
FGEVAKQEEFFNLSHCQLATLISRDDLNVRCESEVFHACIDWVKYDCPQRRFYVQALLRAVRCHALTPRF
LQTQLQKCEILQADARCKDYLVQIFQELTLHKPTQAVPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSNG
SWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECY
YPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMRHHRSALGIT
VHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 69.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001103777
Locus ID 50868
UniProt ID Q9Z2X8
Cytogenetics 9 A3
RefSeq Size 3151
RefSeq ORF 1872
Synonyms INRF2; mKIAA0132
Summary Acts as a substrate adapter protein for the E3 ubiquitin ligase complex formed by CUL3 and RBX1 and targets NFE2L2/NRF2 for ubiquitination and degradation by the proteasome, thus resulting in the suppression of its transcriptional activity and the repression of antioxidant response element-mediated detoxifying enzyme gene expression. Retains NFE2L2/NRF2 and may also retain BPTF in the cytosol. Targets PGAM5 for ubiquitination and degradation by the proteasome (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Cancer: Gastrointestinal, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

OXR1 is a dual redox–mitochondrial checkpoint governing osteoclast differentiation and bone loss in an osteoporosis mouse model
Chen, Zhou, Jin et al
Nature Communications (2026)
AI Summary: OriGene’s human and mouse OXR1 (TP760961) and KEAP1 (TP509525) recombinant proteins were used to study the direct interaction between OXR1 and KEAP1, helping to elucidate OXR1’s regulatory role in osteoclast differentiation and bone loss in osteoporosis.
Snippet: human and mouse OXR1 (No. TP760961) and KEAP1 proteins (OriGene, Nos. TP760961 and TP509525) were used. In these experiments, OXR1 was immobilized onto the chip surface, and increasing concentrations of KEAP1 (10–2560 nM in PBST) were flowed over the surface under identical conditions
Seaweed natural products modify the host inflammatory response via Nrf2 signaling and alter colon microbiota composition and gene expression
Bousquet, Ratnayake, Pope et al
Free Radic. Biol. Med. (2019) 146, 306-323 DOI: 10.1016/j.freeradbiomed.2019.09.013
AI Summary: OriGene’s recombinant Keap1 protein (Keap1-DDK) was used to investigate how cymopol quinone modifies cysteine residues on Keap1, thereby elucidating the mechanism by which seaweed-derived compounds activate Nrf2-mediated antioxidant responses.
Snippet: Skip to article;Recombinant Keap1 protein (Keap1-DDK) (4.2 μM, Origene) dissolved in 20 mM TRIS-HCl (adjusted pH 8.0) was incubated with a solvent control (final 5% DMSO) or 1- and 10-fold excess of CymQ (5) (Experiment-1)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products