OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ncoa4 (BC031528) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509447
Purified recombinant protein of Mouse nuclear receptor coactivator 4 (cDNA clone MGC:28270 IMAGE:4008986), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA332245 Rabbit Polyclonal Anti-Ncoa4 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ncoa4 or BC031528"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209447 protein sequence
Red=Cloning site Green=Tags(s)

MNTSLEQSGCYSNRETLLRCSDARRELELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL
NEQVDLIYQLKEETLQQQAQQLYWLMGQFNCLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLF
EADTSALRQTITTFGSLKTIQIPEHLMAHASSSSIGPFLEKRGYIQVPEQKSASSGTAVSLSEWLLVSKP
AIGLQAPYVPSTNPQDWLIPKQTSENSQTSARACSFFSDAWGNLKGLENWLLNSHQQEIAGKPSSSKCNS
HCSTSSFSPEAEKAEDVELLDQDELDLSDWLVTPQEPCELEKPVDGSWETSEKFKLLFQVFREPYNVSDW
LVKPDSCTNCQGNQPRGVEIENLGNLKCLNDHLEAKKSVSVPSATISEGWLAQNHQDTWKVEEVCKANEP
CTSFAECVCDDNCEKEAVYKWLLKKGGKDKNGMPMEPKSEPEKHRESLTLWLCPSRNELTEQAKAPKALA
PARIADSFHVIKNSSLSEWLIGPTCKGGPKDVPNTEERAGKEMLQSSMATSWCPFNTADWVLPGKKVGSL
SQFPSGEDKWLLRKKAQEERNFRPDCYGLPAVCDLFACMQLKVDKEKWLYRTPLQM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 69.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 27057
Cytogenetics 14 B
RefSeq Size 3378
RefSeq ORF 1848
Synonyms ARA70; Rfg
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Extracellular NCOA4 is a mediator of septic death by activating the AGER-NFKB pathway
Liu, Wang, Zeng et al
Autophagy (2024)
Cited by 27
AI Summary: OriGene's human (TP326691) and mouse (TP509447) recombinant NCOA4 proteins were used in this study to investigate the role of extracellular NCOA4 in mediating septic death and activating the AGER-NFKB pathway.
Snippet: multiplicity of infection [MOI] = 25) or S. enterica (ATCC 13,311;MOI = 25). Human (TP326691) and mouse (TP509447) rNCOA4 were obtained from OriGene, produced from a HEK293T expression system with  90% purity and LPS-free. LPS from E. coli O111:B4 (L4391) were obtained from Sigma-Aldrich. All treatments involving rNCOA4 or LPS
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products