OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ncbp3 (NM_025818) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509440
Purified recombinant protein of Mouse nuclear cap binding subunit 3 (Ncbp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ncbp3 or NM_025818"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209440 representing NM_025818
Red=Cloning site Green=Tags(s)

MAAVRGLRVSVKAEAPAGPALGLPSPEVESGLERGEPEPMEVEEGELEIVPVRRSLKELLPDTSRRYENK
AGSFITGIDVTSKEAIEKKEQRAKRFHFRAEVNLAQRNVALDRDMMKKAIPKVRLETIYICGVDEMSTQD
IFSYFKEYPPAHIEWLDDTSCNVVWLDEMTATRALINMSSLPAQDKMRSRDASEDKSSEKNKKDKQEDSS
DDDETEEGEVEDENSSDVELDTLSQVEEESLLRNDLRPANKLAKGNRLFMRFATKDDKKELGAARRSQYY
MKYGNPNYGGMKGILSNSWKRRYHSRRIQRDVIKKRALIGDDVGLTSYKHRHSGLVNVPEEPIEEEEEEE
EEEEDQDMDADDRVVVEYHEELPGLKQPRERSLSRRSSASSSDSDEMDYDLELKMISTPSPKKSMKMTMY
ADEVESQLKSIRNPMRADSISTSNIKNRIGNKLPPEKFADVRHLLDEKRQHSCPRPAVSSTKPDIRQRLG
KRPYSPEKAFSSNQVVRREPSSDVHSRLGVPRQDVKGLYSDTRERKSGGLWTRLGSTPKTKEKNTKKVDH
RASGAEEDDSELQRAWGALIKEKEESRQKKSRLDSLPSLQIEVSRESSSGSEAES

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 70.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_080094
Locus ID 66874
UniProt ID Q8BZR9
Cytogenetics 11 B4
RefSeq Size 6284
RefSeq ORF 1845
Synonyms 1200014J11Rik; C78393; C130061O14Rik
Summary Associates with NCBP1/CBP80 to form an alternative cap-binding complex (CBC) which plays a key role in mRNA export. NCBP3 serves as adapter protein linking the capped RNAs (m7GpppG-capped RNA) to NCBP1/CBP80. Unlike the conventional CBC with NCBP2 which binds both small nuclear RNA (snRNA) and messenger (mRNA) and is involved in their export from the nucleus, the alternative CBC with NCBP3 does not bind snRNA and associates only with mRNA thereby playing a role in only mRNA export. The alternative CBC is particularly important in cellular stress situations such as virus infections and the NCBP3 activity is critical to inhibit virus growth (PubMed:26382858).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products