Arid3a (NM_007880) Mouse Recombinant Protein

CAT#: TP509313

Purified recombinant protein of Mouse AT rich interactive domain 3A (BRIGHT-like) (Arid3a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209313 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLQAVMETLIQRQQRARQELEARQAPPPPPPEPTGVRARTTMTDEDREPENARMHRTQMAALAAMRAAA
  AGLGHPSSPGGSEDGPPISGDEDTAREGTLSSPALHGSVLEGAGHAEGDRHLMDVGSDDDDTKSKWEEQE
  LEELGEEEEEEEEEDDFEEEEEEEEGLGPPESASLGTAGLFTRKAPPAQAFRGDGGPRMLSGPERLGPGP
  AHPSHMASQMPPPDHGDWTFEEQFKQLYELDADPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFML
  YVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECERRGLSSPNELQAAIDSN
  RREGRRQSFGGSLFAYSPSGAHSMLPSPKLPVTPLGLAASTNGSSITPAPKIKKDSAIPITVPGRLPVSL
  AGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESTEPPEKKMALVADEQQRLMQRAVQQSFLAMTA
  QLPMNIRINSQASESRQDSAVSLTSANGSNSISMSVEMNGIVYTGVLFAQPPPPTAPSAPGKGGVSSIGT
  NTTTGSRTGASGSTVSGGQVGLPGVSTPTMSSTSNNSLP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 63.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031906
• Locus ID: 13496
• UniProt ID: Q62431
• Cytogenetics: 10 C1
• Refseq Size: 5361
• Refseq ORF: 1800
• Synonyms: Bright; Dri1; Dril1
• Summary: Transcription factor involved in B-cell differentiation. Binds a VH promoter proximal site necessary for induced mu-heavy-chain transcription. Binds the minor groove of a restricted ATC sequence that is sufficient for nuclear matrix association. This sequence motif is present in matrix-associating regions (MARS) proximal to the promoter and flanking E mu. Activates E mu-driven transcription by binding these sites. May be involved in the control of cell cycle progression by the RB1/E2F1 pathway.[UniProtKB/Swiss-Prot Function]