OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ccdc155 (NM_201374) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509060
Purified recombinant protein of Mouse coiled-coil domain containing 155 (Ccdc155), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ccdc155 or NM_201374"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209060 protein sequence
Red=Cloning site Green=Tags(s)

MDLPEGQAGGPTAQMYLWEQPEEASSRPLLSLEEQILNSTFEACDPHKTGTVTVAHLLAYLEAVTGQGPQ
DVRLQTLARSLDPYGEGAEATVELDTFLVVMRDWIAACQLQGGLERAEETAYEGALASPHLPSVCPEAEE
SANLESFGGEDPRPEGPATAELLSNLEDLELSNRRLAGENAKLQRSVETAEEGSARLGEEITALRKQLRS
TQQALQVAKALDEELEDLKTLAKSLEEQNRSLMAQARHTEKEQQHLAAEVETLPEENEKLLAERDGVKRR
SEELATEKDALKRQLCECERLICQREAVLSERTRHAESLARTLEEYRTTTQELRQEISNLEEQLSQSQEG
PEELLEGAEAGRVGWIMALPPSLDLEIQAIRQEQDVASAGLSSPLYGVRQWEEVEPEPEPEPEPEPEPEP
QEVEFPSEDPARQQTDLQREPVRALEGSRAPCLRLSRSQEEEEEEEESWVLADPSSPLGTYHHKLAPGSS
RESCHIVPEMHQALMPVVRDLVPVERSRTQHCLHPQHSPGIRISQHPLVPTPVLGLLLLLLLSILLFSQS
PPPTWPHLQLYYLQPPPV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 64.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_958762
Locus ID 384619
UniProt ID Q80VJ8
Cytogenetics 7 B3
RefSeq Size 2210
RefSeq ORF 1734
Synonyms Gm1434; KASH5
Summary As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. Required for telomere attachment to nuclear envelope in the prophase of meiosis and for rapid telomere prophase movements implicating a SUN1/2:KASH5 LINC complex in which SUN1 and SUN2 seem to act at least partial redundantly. Required for homologue pairing during meiotic prophase in spermatocytes and probably oocytes. Essential for male and female gametogenesis. Recruits cytoplasmic dynein to telomere attachment sites at the nuclear envelope in spermatocytes. In oocytes is involved in meiotic resumption and spindle formation.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products