OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tkfc (NM_145496) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509059
Purified recombinant protein of Mouse triokinase, FMN cyclase (Tkfc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA357230 TKFC Antibody - N-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Tkfc or NM_145496"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209059 representing NM_145496
Red=Cloning site Green=Tags(s)

MSSKKMVNSVEGCADDALAGLVASNPDLQLLQGHRVALRSDLDTLKGRVALLSGGGSGHEPAHAGFIGKG
MLTGVIAGSVFASPPVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAMEQAKAEGISVEMVIVEDD
SAFTVLKKAGRRGLCGTVLIHKVAGALAEEGMGLEEITKRVSVIAKTMGTLGVSLSSCSVPGATHTFELA
ADEIELGLGIHGEAGVRRIKIAPVDQIVTLMLDHMTNTSNIFHVPVRSGSSVVLIVNNLGGLSFLELGII
ADAAIRLLEGRGVKVARALVGTFMSALEMPGVSLTLMLVDEPVLKLIDAETTAKAWPHMAKVSVTGRKRI
RAAPTEPPEAPEATAAGGVTSKQMALVLDRICTTLIGLEEHLNALDRAAGDGDCGSTHSRAAKAIQGWLK
EGPSLTSPAQVLSRLSVLLLERMGGSSGALYGLFLTAAAQPLKAKTDLPTWSAAMDAGLESMQKYGKAAP
GDRTMLDSLWAAAQEFQAWKSPGASLLPVLTKAVKSAEAAAEATKNMEAGAGRASYISSAQLDQPDPGAV
AAAAIFRAILEVLQTQGA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 59.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_663471
Locus ID 225913
UniProt ID Q8VC30
Cytogenetics 19 A
RefSeq Size 2350
RefSeq ORF 1734
Synonyms BC021917; Dak
Summary Catalyzes both the phosphorylation of dihydroxyacetone and of glyceraldehyde, and the splitting of ribonucleoside diphosphate-X compounds among which FAD is the best substrate. Represses IFIH1-mediated cellular antiviral response.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Knockdown of Ketohexokinase Versus Inhibition of Its Kinase Activity Exert Divergent Effects on Fructose Metabolism
Park, Fadhul, Conroy et al
JCI Insight (2024)
Cited by 21
AI Summary: OriGene’s recombinant mouse TKFC protein (TP509059) was used to measure TKFC enzymatic activity, helping the researchers distinguish the metabolic effects of KHK inhibition versus knockdown in fructose metabolism.
Snippet: KHK activity was measured with luminescence-based method as previously published (32). TKFC activity was measured using mouse recombinant TKFC protein (Origene, TP509059). The assay measures ADP production in a reaction where D-glyceraldehyde (GA) and ATP are converted by Dglyceraldehyde-3Phospate and ADP. Recombinant TKFC protein was preincubated with KHK inhibitor
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products