OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Scg2 (BC048249) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509051
Purified recombinant protein of Mouse secretogranin II (cDNA clone MGC:54765 IMAGE:6493827), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Scg2 or BC048249"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209051 protein sequence
Red=Cloning site Green=Tags(s)

MAGAKAYRLGAVLLLIHLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIEKLRQQAH
REESSPDYNPYQGVSVPLQLKENGEESHLAESSRDALSEDEWMRIILEALRQAENEPPSAPKENKPYALN
LEKNFPVDTPDDYETQQWPERKLKHMRFPLMYEENSRENPFKRTNEIVEEQYTPQSLATLESVFQELGKL
TGPSNQKRERVDEEQKLYTDDEDDVYKTNNIAYEDVVGGEDWSPIEEKIETQTQEEVRDSKENTEKNEQI
NEEMKRSGQLGLPDEENRRESKDQLSEDASKVITYLRRNLQIPPEDLIEMLKAGEKPNGLVEPEQDLELA
VDLDDIPEADLDRPDMFQSKMLSKGGYPKAPGRGMVEALPDGLSVEDILNVLGMENVVNQKSPYFPNQYS
QDKALMRLPYGPGKSRANQIPKVAWIPDVESRQAPYENLNDQELGEYLARMLVKYPELLNTNQLKRVPSP
VSSEDDLQEEEQLEQAIKEHLGPGSSQEMERLAKVSKRIPVGSLKNEDTPNRQYLDEDMLLKVLEYLNQE
QAEQGREHLAKRAMENM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 66.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 20254
UniProt ID Q03517
Cytogenetics 1 40.89 cM
RefSeq Size 2211
RefSeq ORF 1731
Synonyms Chgc; SgII
Summary Neuroendocrine protein of the granin family that regulates the biogenesis of secretory granules.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

REST Regulates Non-Cell-Autonomous Neuronal Differentiation and Maturation of Neural Progenitor Cells via Secretogranin II
Kim, Denli, Wright et al
J. Neurosci. (2015) 35 (44), 14872-84 DOI: 10.1523/JNEUROSCI.4286-14.2015
AI Summary: OriGene contributed to this study by providing recombinant SCG2 protein, which was used to assess its role in rescuing neuronal differentiation phenotypes following REST knockdown.
Snippet: Cells under differentiation conditions were cultured for 3–6 d after addition of RA. Cells were transfected using Nucleofector (Amaxa). Recombinant SCG2 (MW 70.8 kDa, NP_003460) was purchased from Origene and used at 20 ng/ml, resuspended in 0.1% BSA in ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products