OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Chaf1b (NM_028083) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509007
Purified recombinant protein of Mouse chromatin assembly factor 1, subunit B (p60) (Chaf1b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Chaf1b or NM_028083"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209007 representing NM_028083
Red=Cloning site Green=Tags(s)

MEPGNLTWVSEFVFLGFSEIWELQVFLFVVFLCVYSTTVVGNLLIIVTVSSDPRLHTPMYFLLRNLAVLD
LCFSSVTAPKMLVDFLSEKKTISYRGCMVQIFFFHFLGGAMVFFLSVMAYDRLVAISRPLHYVTIMNSQL
CMGLVVASWVGGFAHSIVQLSLMLPLPFCGPNVLDNFYCDVPQVLRLACMDTSLLEFLMISNSGMLDVIW
FFLLLISYLVILVMLRSHSGEARRKAASTCTTHIIVVSMIFIPSIYLYARPFTPFTMDKAVSISHTVMTP
MLNPMIYTLRNQEMQAAMKRLAKRLALCNRE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 63.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_082359
Locus ID 110749
UniProt ID Q9D0N7
Cytogenetics 16 54.96 cM
RefSeq Size 1913
RefSeq ORF 933
Synonyms 2600017H24Rik; C76145; CAF-I p60; CAF-Ip60; CAF1; CAF1A; CAF1P60; MPHOSPH7
Summary Complex that is thought to mediate chromatin assembly in DNA replication and DNA repair. Assembles histone octamers onto replicating DNA in vitro. CAF-1 performs the first step of the nucleosome assembly process, bringing newly synthesized histones H3 and H4 to replicating DNA; histones H2A/H2B can bind to this chromatin precursor subsequent to DNA replication to complete the histone octamer (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products