OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Dpysl3 (NM_009468) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508981
Purified recombinant protein of Mouse dihydropyrimidinase-like 3 (Dpysl3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Dpysl3 or NM_009468"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208981 representing NM_009468
Red=Cloning site Green=Tags(s)

MLNGSVVTTFFLSGLPHPPVLDSMLFGIFLVIYILTVLGNLLILMVIRVDSHLHTPMYYFLTNLSFIDMW
FSTVTVPKMLMTLVSTGGGAISFHSCVAQLYCFHFLGSTECFLYTVMSYDRYLAISYPLRYSSMMSGRVC
ALLAAGTWITGSLHSAVQTTLIFHLPYCGPNEIQHYFCDGPPILKLACADTSAIEMVIFVNIGVVASGCF
FLISLSYVSIVCSILRIRTSEGRHRAFQTCASHCIVVLCFFVPCVFIYLRPGSRDAVDGVVTVFYTVLTP
LLNPVVYTLRNKEVKKALFKLKDKVAFSQR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 62.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_033494
Locus ID 22240
UniProt ID Q62188
Cytogenetics 18 B3
RefSeq Size 2076
RefSeq ORF 930
Synonyms CRMP; CRMP-4; DRP-3; TUC4; U; Ul; Ulip; ULIP-1; Ulip1
Summary This gene encodes a protein that belongs to the TUC (TOAD-64/Ulip/CRMP) family of proteins. Members of this family are phosphoproteins that function in axonal guidance and neuronal differentiation during development and regeneration of the nervous system. A mutation in the human gene is associated with amyotrophic lateral sclerosis. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Apr 2014
Protein Categories Cytokines, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products