OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Eif2d (NM_001136070) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508977
Purified recombinant protein of Mouse eukaryotic translation initiation factor 2D (Eif2d), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Eif2d or NM_001136070"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208977 representing NM_001136070
Red=Cloning site Green=Tags(s)

MGNVPLLREVGKCQRNMFGRSTASSKGSSNSRSSSSTSPKKGPRREADALMFIQIFIHLLKSNIGTGFLG
LPLAVKNAGLLVGPVSLLAIGALTVHCMDILLNCACHLTQRLQRSFVNYEETTMYSLETCPSPWLRTHSV
WGRYVVSFLLIVTQLGFCSVYFMFLADNLQQIMEEAHFTSNVCQPRQSLVMTSILDTRFYMLTILPFLIL
LVLIQNPQVLSIFSTLATITTLSSLALIFEYLIQTPHHSNLPLVANWKTFLLFFGTAIFTFEGVGMVLPL
KSQMKSPQQFPAVLYLGMSFVIFLYICLGTLGYMKFGTDTQASITLNLPICWLYQSVKLMYSVGIFFTYA
LQFHVPAEIIVPYVVSRVSENWALFVDLTVRTALVCLTCFSAVLIPRLDLVISLVGSVSSSALAIIIPPL
LEIATFYSENISCATIVKDIMISILGLLGCVLGTYQALYEMTQQTHFYMANSTRVHI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 63.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001129542
Locus ID 16865
UniProt ID Q61211
Cytogenetics 1 56.9 cM
RefSeq Size 1976
RefSeq ORF 1431
Synonyms D1Ertd5e; Lgtn
Summary Translation initiation factor that is able to deliver tRNA to the P-site of the eukaryotic ribosome in a GTP-independent manner. The binding of Met-tRNA(I) occurs after the AUG codon finds its position in the P-site of 40S ribosomes, the situation that takes place during initiation complex formation on some specific RNAs. Its activity in tRNA binding with 40S subunits does not require the presence of the aminoacyl moiety. Possesses the unique ability to deliver non-Met (elongator) tRNAs into the P-site of the 40S subunit. In addition to its role in initiation, can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products