OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Dis3 (BC027357) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508938
Purified recombinant protein of Mouse DIS3 mitotic control homolog (S. cerevisiae) (cDNA clone MGC:37123 IMAGE:4952415), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Dis3 or BC027357"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208938 protein sequence
Red=Cloning site Green=Tags(s)

MLRSKTFLKKTRAGGVVKIVREHYLRDDIGCGAPACSACGGAHAGPALELQPRDQASSLCPWPHYLLPDT
NVLLHQIDVLEHPAIKNVIVLQTVMQEVRNRSAPIYKRIRDVTNNQEKHFYTFTNEHHKETYIEQEQGEN
ANDRNDRAIRVAAKWYNEHLKRVAADSQLQVILITNDRKNKEKAVQEGIPAFTCEEYVKSLTANPELIDR
LAYLSDEMNEIESGKIIFSEHLPLSKLQQGIKSGSYLQGTFRASRENYLEATVWIHGDKEEEKEILIQGI
KHLNRAVHEDIVAVELLPRSQWVAPSSVVLDDEGQNEDDVEKDEERELLLKTAVSEKMLRPTGRVVGIIK
RNWRPYCGMLSKSDIKESRRHLFTPADKRIPRIRIETRQASALEGRRIIVAIDGWPRNSRYPNGHFVKNL
GDVGEKETETEVLLLEHDVPHQPFSQAVLSFLPRMPWSITEEDMKNREDLRHLCVCSVDPPGCTDIDDAL
HCRELSNGNLEVGVHIADVSHFIRPGNALDQESARRGTTVYLCEKRIDMVPELLSSNLCSLRSNVDRLLL
RTRKHR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 64.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 72662
UniProt ID Q9CSH3
Cytogenetics 14 E2.2
RefSeq Size 2996
RefSeq ORF 1698
Synonyms 2810028N01Rik
Summary Putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. DIS3 has both 3'-5' exonuclease and endonuclease activities.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products