Trim26 (NM_001025599) Mouse Recombinant Protein

CAT#: TP508686

Purified recombinant protein of Mouse tripartite motif-containing 26 (Trim26), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208686 representing NM_001025599
  Red=Cloning site Green=Tags(s)
  
  MAVSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTSDIRPISGNRPVCPLCKKPFKKENIRPVWQ
  LASLVENIERLKVDNGRQPGELAREPQDMKLCERHQEKLHYYCEDDGKLLCVMCRESREHRPHTAVLVEK
  AALPHREKILNHLNTLRRDRDKIQGFQAKGEADILAALTKLQEQRQYIVAEFKQGHQFLKKREQHLLDQL
  ATLEQLLTEGREKFKTRGVSELDRLTLVISELEGKARQPAAELMQDVCTTQDTKDFANKYPRKKFWIGKA
  IPHMVKRKAGEFSDKLLSLQRGLRQFQGKLLRDLEYKTVSVTLDPQSASGYLHLSEDWKCVTYTGQYQSD
  CLLPQQFDCEPGVLGSKGFTWGKVYWEVELEREGWSEDEEEGEEEEEGEEEEEDEEVGYGDGYEDWETDE
  EDESLGEEEEEEEEEEEEVQESCMVGVAKDSVKRKGDLSLRPEDGVWALRLSPSGIWANTSPEAQLFPVL
  RPRRVGIALDYEGGTVTFTNAESQELIYTFTTTFTRRLVPFLWLKWPGARLLLRP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 62.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001020770
• Locus ID: 22670
• UniProt ID: Q99PN3
• Cytogenetics: 17 19.16 cM
• Refseq Size: 3231
• Refseq ORF: 1635
• Synonyms: AI462198; Zfp173; Zfp1736
• Summary: E3 ubiquitin-protein ligase which regulates the IFN-beta production and antiviral response downstream of various DNA-encoded pattern-recognition receptors (PRRs). Promotes nuclear IRF3 ubiquitination and proteasomal degradation. Bridges together TBK1 and NEMO during the innate response to viral infection leading to the activation of TBK1.[UniProtKB/Swiss-Prot Function]