Cct5 (NM_007637) Mouse Recombinant Protein

CAT#: TP508636

Purified recombinant protein of Mouse chaperonin containing Tcp1, subunit 5 (epsilon) (Cct5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208636 representing NM_007637
  Red=Cloning site Green=Tags(s)
  
  MASVGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTI
  TNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQA
  ARIAIQHLDKISDKVLVDINNPEPLIQTAKTTLGSKVINSCHRQMAEIAVNAVLTVADMERRDVDFELIK
  VEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVVDAKIAILTCPFEPPKPKTKHKLDVMSVEDYKALQKY
  EKEKFEEMIKQIKETGANLAICQWGFDDEANHLLLQNGLPAVRWVGGPEIELIAIATGGRIVPRFSELTS
  EKLGFAGVVQEISFGTTKDKMLVIEKCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVY
  GGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALG
  IDCLHKGSNDMQYQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 59.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031663
• Locus ID: 12465
• UniProt ID: P80316
• Cytogenetics: 15 B2
• Refseq Size: 1769
• Refseq ORF: 1623
• Synonyms: CCT-epsilon; Ccte; mKIAA0098; TCP-1-epsilon; TCPE
• Summary: Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis. The TRiC complex mediates the folding of WRAP53/TCAB1, thereby regulating telomere maintenance. As part of the TRiC complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. The TRiC complex plays a role in the folding of actin and tubulin.[UniProtKB/Swiss-Prot Function]