OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Yars (NM_134151) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508462
Purified recombinant protein of Mouse tyrosyl-tRNA synthetase (Yars), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Yars or NM_134151"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208462 protein sequence
Red=Cloning site Green=Tags(s)

MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVT
ILFADLHAYLDNMKAPWELLELRTSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVV
TQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFAEKYLPALGYSKRVHL
MNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRD
EKWGGNKTYTVYLELEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPP
AKGPAKNSEPEEVIPSRLDIRVGKILSVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV
VVLCNLKPQKMRGVDSQGMLLCASVEGVSRQVEPLDPPAGSAPGERVFVQGYEKGQPDEELKPKKKVFEK
LQADFKISEECIAQWKQTNFMTKLGFVSCKSLKGGNIS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 59.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_598912
Locus ID 107271
UniProt ID Q91WQ3
Cytogenetics 4 D2.2
RefSeq Size 2874
RefSeq ORF 1584
Synonyms AL024047; AU018965
Summary Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Enzyme: Ligase, Intracellular Proteins, Nervous system: Neurodegenerative diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Prolonged hypernutrition impairs TREM2-dependent efferocytosis to license chronic liver inflammation and NASH development
Wang, He, Zhou et al
Immunity (2022) 56 (1), 58-77.e11 DOI: 10.1016/j.immuni.2022.11.013
Cited by 257
AI Summary: In this study, OriGene’s recombinant mouse Rps19 (TP519906) and Yars (TP508462) proteins were used to investigate the molecular mechanisms underlying impaired efferocytosis and chronic liver inflammation during NASH development.
Snippet: Recombinant Mousec/Fractalkine (Full Length), CF R&D 472-FF-025/CF Rps19 (NM_023133) Mouse Recombinant Protein Origene TP519906 Yars (NM_134151) Mouse Recombinant Protein Origene TP508462 Flavopiridol (Alvocidib) Selleck S1230
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products