OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Lipc (NM_008280) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508201
Purified recombinant protein of Mouse lipase, hepatic (Lipc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Lipc or NM_008280"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208201 protein sequence
Red=Cloning site Green=Tags(s)

MGNPLQISIFLVFCIFIQSSACGQGVGTEPFGRSLGATEASKPLKKPETRFLLFQDENDRLGCRLRPQHP
ETLQECGFNSSQPLIMIIHGWSVDGLLENWIWKIVSALKSRQSQPVNVGLVDWISLAYQHYTIAVQNTRI
VGQDVAALLLWLEESAKFSRSKVHLIGYSLGAHVSGFAGSSMDGKNKIGRITGLDPAGPMFEGTSPNERL
SPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAH
ERSVHLFIDSLQHSDLQSIGFQCSDMGSFSQGLCLSCKKGRCNTLGYDIRKDRSGKSKRLFLITRAQSPF
KVYHYQFKIQFINQIEKPVEPTFTMSLLGTKEEIKRIPITLGEGITSNKTYSFLITLDKDIGELILLKFK
WENSAVWANVWNTVQTIMLWGIEPHHSGLILKTIWVKAGETQQRMTFCPENLDDLQLHPSQEKVFVNCEV
KSKRLTESKEQMSQETHAKK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 57.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_032306
Locus ID 15450
UniProt ID P27656
Cytogenetics 9 39.57 cM
RefSeq Size 1934
RefSeq ORF 1530
Synonyms AI256194; HL; Hpl
Summary Hepatic lipase has the capacity to catalyze hydrolysis of phospholipids, mono-, di-, and triglycerides, and acyl-CoA thioesters. It is an important enzyme in HDL metabolism. Hepatic lipase binds heparin.UniProtKB/Swiss-Prot Function
Protein Categories Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Downregulation of hepatic lipase is associated with decreased CD133 expression and clone formation in HepG2 cells
Liu, Zuo, Fang et al
Int. J. Mol. Med. (2018)
AI Summary: OriGene's pCMV6-Kan/Neo plasmid was used to clone the mouse LIPC gene, enabling the researchers to study the effects of LIPC downregulation on CD133 expression and clone formation in HepG2 cells.
Snippet: The mouse LIPC gene sequence (NM-008280) was amplified by PCR and cloned into the pCMV6-Kan/Neo plasmid (OriGene, Rockvile, MD, USA). A specific LIPC siRNA sequence was designed as: 5'-GGA GAA ACC CAG CAA AGA AdTdT-3' (10)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products