Hspa14 (NM_015765) Mouse Recombinant Protein

CAT#: TP508190

Purified recombinant protein of Mouse heat shock protein 14 (Hspa14), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified Hspa14 protein (Cat# TP508190). The protein was produced from HEK293T cells transfected with Hspa14 cDNA clone (Cat# MR208190) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208190 representing NM_015765
  Red=Cloning site Green=Tags(s)
  
  MAAIGVHLGCTSACVAVYKDGRADVVANDAGDRVTPAIVAYSEREQVVGLAAKQSRIRHVSSTVVKVKQI
  LGRSSADPQAQKYISESKCLVIEKNGKLRYEIDTGEETKLVNPEDVARLIFSKMKETAHSVLGSDANDVV
  VTVPFDFGEKQKSALGEAAGAAGFNVLRLIHEPSAALLAYGIGQDHPTGKSNVLVFKLGGTSLSLSVMEV
  NSGMYRVLSTNTSDNIGGAHFTDTLAQYLASEFQRLFKHDVRGNARAMMKLMNSAEVAKHSLSTLGSANC
  FVDSLYEGQDFDCNVSRARFELLCSPLFNKCTEAIRELLRQTGFTADDINKVVLCGGSSRIPKLQQLIKD
  LFPAVDLLNSIPPDEVIPIGAAIEAGILVGKESTSGDDSVMIECSAKDILVKGVDESGADRFTVLFPSGT
  PLPARRQHTLQAPGRVSSVCLELYESEGKNSAKEEAKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLQV
  TCTDQDTGKCEAITVEVAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 54.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056580
• Locus ID: 50497
• UniProt ID: Q99M31
• Cytogenetics: 2 A1
• Refseq Size: 1791
• Refseq ORF: 1527
• Synonyms: 70kDa; Hsp70-4; HSP70L1; hsr.1; NST-1
• Summary: Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function]